General Information

  • ID:  hor006606
  • Uniprot ID:  O62692
  • Protein name:  Pro-MCH variant
  • Gene name:  PMCHL1
  • Organism:  Pan paniscus (Pygmy chimpanzee) (Bonobo)
  • Family:  Melanin-concentrating hormone family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pan (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0030354 melanin-concentrating hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0045202 synapse

Sequence Information

  • Sequence:  KHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPIGRRDFD
  • Length:  62
  • Propeptide:  KHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPIGRRDFD
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006606_AF2.pdbhor006606_ESM.pdb

Physical Information

Mass: 801983 Formula: C304H472N86O100
Absent amino acids: CMW Common amino acids: EL
pI: 4.7 Basic residues: 9
Polar residues: 18 Hydrophobic residues: 19
Hydrophobicity: -79.19 Boman Index: -14922
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 70.81
Instability Index: 4167.1 Extinction Coefficient cystines: 1490
Absorbance 280nm: 24.43

Literature

  • PubMed ID:  9491616
  • Title:  Emergence of a brain-expressed variant melanin-concentrating hormone gene during higher primate evolution: a gene "in search of a function".